Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YAL007C  from Saccharomyces cerevisiae S288C
>YAL007C|YAL007C ERP2 SGDID:S000000005, Chr I from 138345-137698, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein that forms a heterotrimeric complex with Erp1p, Emp24p, and Erv25p; member, along with Emp24p and Erv25p, of the p24 family involved in ER to Golgi transport and localized to COPII-coated vesicles" ORGANISM: Saccharomyces cerevisiae S288C (215 aa)
MIKSTIALPSFFIVLILALVNSVAASSSYAPVAISLPAFSKECLYYDMVTEDDSLAVGYQ
VLTGGNFEIDFDITAPDGSVITSEKQKKYSDFLLKSFGVGKYTFCFSNNYGTALKKVEIT
LEKEKTLTDEHEADVNNDDIIANNAVEEIDRNLNKITKTLNYLRAREWRNMSTVNSTESR
LTWLSILIIIIIAVISIAQVLLIQFLFTGRQKNYV